PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT17114
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB
Protein Properties Length: 951aa    MW: 104841 Da    PI: 4.8283
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT17114genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.82.1e-121149948
                     HHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  9 dellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     d++l +av+ + g++Wk+Ia++++  Rt+ qc +rwqk+l
         EMT17114 11 DDILSRAVQTYNGKNWKKIAECFP-DRTDVQCLHRWQKVL 49
                     67899*******************.************986 PP

2Myb_DNA-binding61.22.1e-1955101148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd+++v+ vk++G++ W+tIa+ ++ gR +kqc++rw+++l
         EMT17114  55 KGPWSKEEDDIIVEMVKKYGPKKWSTIAQALP-GRIGKQCRERWHNHL 101
                      79******************************.*************97 PP

3Myb_DNA-binding49.11.3e-15107149145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT+eE+  l++a++++G++ W+   + ++ gRt++++k++w+
         EMT17114 107 KDAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNSIKNHWN 149
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.7E-5551IPR001005SANT/Myb domain
CDDcd001671.05E-91149No hitNo description
PfamPF002494.9E-101149IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-191166IPR009057Homeodomain-like
PROSITE profilePS500907.71149IPR017877Myb-like domain
SuperFamilySSF466893.01E-111159IPR009057Homeodomain-like
PROSITE profilePS5129432.21550105IPR017930Myb domain
SuperFamilySSF466892.55E-3152148IPR009057Homeodomain-like
SMARTSM007171.2E-1854103IPR001005SANT/Myb domain
CDDcd001674.44E-1657101No hitNo description
PfamPF139213.5E-1858118No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2667108IPR009057Homeodomain-like
PROSITE profilePS5129419.934106156IPR017930Myb domain
SMARTSM007171.9E-14106154IPR001005SANT/Myb domain
CDDcd001673.91E-11109149No hitNo description
Gene3DG3DSA:1.10.10.601.6E-21109156IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 951 aa     Download sequence    Send to blast
MAIHCPNGWM DDILSRAVQT YNGKNWKKIA ECFPDRTDVQ CLHRWQKVLN PELIKGPWSK  60
EEDDIIVEMV KKYGPKKWST IAQALPGRIG KQCRERWHNH LNPGINKDAW TQEEEITLIH  120
AHRMYGNKWA ELTKFLPGRT DNSIKNHWNS SVKKKIDSYM SSGLLAQVSR LPLIEHHAHF  180
NSSPAITQQN SEDSDSNAAR EVEDSSGCSQ SSLAMVSCSQ VQDTNLALSC DLHVNADTSK  240
TEARDSQSSM CQEDYTSTEG VASALSEVHC HASSSRFGPD KLLQQDISQR MNLQMDIDET  300
PGNSMFENNQ TICSTSNNER PMLQYEIAPD MPISVLTNVS GAEQKLHFMS EADFSSPNCL  360
KSELWQEISF QSLLSGPDIV DADSLSRLNH HSDTHSSEAD TNFLAAPNPS HTSNPSSMMV  420
AAYGQDPSLS VPQSLISNGL SDAADEKSGE MQVSGSEMIT CMHDSFGDSE QFATPGSTDG  480
RHGASAIIER IPEYGDKQLT DAEEPAASMA KEPPLAQGEA ASDEKQDKGA LFYEPPRFPS  540
MDVPFVSCDL VTSGDLQEYS PLGIRQLMRS TMSVTTPLRL WGSPTHDESP DVVLKSAAKS  600
FISTPSILKK RQRDLSSPTP EKRMERKSRT EQDSGVLGTS SVSAQTSCMH AIKDKAIVTE  660
SVFCTNRSSS FKPLEKKLEF CDENKENLGE SEQAKDGRNA QNNHTVDEHA RGEQCSTANM  720
VNTNDEPPAT VLVEHKGNDI SDHGANAMYQ KMNTNLEALS ACKEAFAKSK SGELIAEKSS  780
PCIQMDYEYV NILADTPGVK RGLESPSAWK SPWFIDMQYK GSYFISPADT TYDALGLMKR  840
INVQSASALA DAREVLASGS QCGNKNFDEE NKENIDAENE TGTGKPQNKI MLTLQAEARV  900
LDFNECATPT QTFTVLSFMY SLVFLGVFYL PIVSTSDSNK VALDICHVPL P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C1e-641115614159MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-641115614159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHE9968270.0HE996827.1 Triticum aestivum cv. Arina SNP, chromosome 3B, clone Taes_arina_ctg_69800.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230653.10.0PREDICTED: myb-related protein 3R-1-like isoform X1
RefseqXP_014753766.10.0PREDICTED: myb-related protein 3R-1-like isoform X2
TrEMBLN1QYF00.0N1QYF0_AEGTA; Myb-related protein 3R-1
STRINGMLOC_10556.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.15e-94Homeodomain-like protein